PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G014470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family NAC
Protein Properties Length: 474aa    MW: 53598.2 Da    PI: 6.4684
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G014470.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.48.1e-51151431128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi+evd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkat
  HL.SW.v1.0.G014470.1  15 VPPGFRFHPTEEELLHYYLRKKVAFEKIDL-DVIREVDLNKLEPWDIQEKCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKAT 102
                           69****************************.9***************964444222455****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           g+dk ++s + + +gl+ktLvfykgrap+g+k+dW+mheyrl
  HL.SW.v1.0.G014470.1 103 GRDKIIYS-GFKRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 143
                           ********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-5610184IPR003441NAC domain
PROSITE profilePS5100555.60615184IPR003441NAC domain
PfamPF023651.8E-2616143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MSEDMNLSIN GQSQVPPGFR FHPTEEELLH YYLRKKVAFE KIDLDVIREV DLNKLEPWDI  60
QEKCKIGSTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKIIYS GFKRIGLRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDESTHDS TVVSPPNPKA HVSNQMVADS VSEDGWVVCR  180
VFKKKNYQKS LDSPKGATSS SMSGDSNMNN NGNNHSHLHH HLQMPCPRND GVLDQILLYM  240
GRTCKLENDS LANISAERYL TSSNKNATVG GGDAVFHQNF MHLPRLQESP TTTTTTTTTN  300
NNNNNSSTLH SLPLNDSVSP YKPYSYDHHQ SMEYDMLMET EPSSSDHRRT EDPKPVMVSN  360
RVNDWVALDR LVASQLNGQD HEETSKQVLS CFGDIQNVMS FCTTDPQTVV DDEDDVEQMS  420
SYPYLRSGTD MTTSTRTTSN LHNQNYNEND LWSFARSSSS PSSSSDPLCH LSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-471518615170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010100216.10.0NAC domain-containing protein 43
SwissprotQ84WP61e-113NAC43_ARATH; NAC domain-containing protein 43
TrEMBLW9RML10.0W9RML1_9R
STRINGPOPTR_0011s15640.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-99NAC family protein